Protein Info for HEPCGN_13950 in Escherichia coli ECOR38

Name: nepI
Annotation: purine ribonucleoside efflux pump NepI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 35 to 59 (25 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 351 (311 residues), 131.5 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 100% identical to NEPI_ECOBW: Purine ribonucleoside efflux pump NepI (nepI) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03445, MFS transporter, DHA1 family, purine ribonucleoside efflux pump (inferred from 98% identity to ecz:ECS88_4087)

MetaCyc: 100% identical to purine ribonucleoside exporter (Escherichia coli K-12 substr. MG1655)
RXN0-18; RXN0-22

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>HEPCGN_13950 purine ribonucleoside efflux pump NepI (Escherichia coli ECOR38)
MLKWSAFPLKHATGNTMSEFIAENRGADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLT
PMAQDLGISEGVAGQSVTVTAFVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSF
ANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLG
SFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIA
IFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLAL
AGAPLILAVSALVLTLWGSDKIVATGVAIIWGLTFALVPVGWSTWITRSLADQAEKAGSI
QVAVIQLANTCGAAIGGYALDNIGLTSPLMLSGTLMLLTALLVTAKVKMK