Protein Info for HEPCGN_13930 in Escherichia coli ECOR38

Name: adeQ
Annotation: adenine permease AdeQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 32 to 405 (374 residues), 156.6 bits, see alignment E=4.2e-50

Best Hits

Swiss-Prot: 100% identical to ADEQ_ECOLI: Adenine permease AdeQ (adeQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to eco:b3664)

MetaCyc: 100% identical to adenine transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-577

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>HEPCGN_13930 adenine permease AdeQ (Escherichia coli ECOR38)
MNNDNTDYVSNESGTLSRLFKLPQHGTTVRTELIAGMTTFLTMVYIVFVNPQILGAAQMD
PKVVFVTTCLIAGIGSIAMGIFANLPVALAPAMGLNAFFAFVVVGAMGISWQTGMGAIFW
GAVGLFLLTLFRIRYWMISNIPLSLRIGITSGIGLFIALMGLKNTGVIVANKDTLVMIGD
LSSHGVLLGILGFFIITVLSSRHFHAAVLVSIVVTSCCGLFFGDVHFSGVYSIPPDISGV
IGEVDLSGALTLELAGIIFSFMLINLFDSSGTLIGVTDKAGLIDSNGKFPNMNKALYVDS
VSSVAGAFIGTSSVTAYIESTSGVAVGGRTGLTAVVVGVMFLLVMFFSPLVAMVPPYATA
GALIFVGVLMTSSLARVNWDDFTESVPAFITTVMMPFTFSITEGIALGFMSYCIMKVCTG
RWRDLNLCVVVVAALFALKIILVD