Protein Info for HEPCGN_13260 in Escherichia coli ECOR38

Name: rffC
Annotation: dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR02382: TDP-D-fucosamine acetyltransferase" amino acids 44 to 224 (181 residues), 323.5 bits, see alignment E=1.9e-101 PF00583: Acetyltransf_1" amino acids 115 to 208 (94 residues), 27.4 bits, see alignment E=3.7e-10

Best Hits

Swiss-Prot: 100% identical to WECD_ECOLI: dTDP-fucosamine acetyltransferase (wecD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3790)

MetaCyc: 100% identical to RffC (Escherichia coli K-12 substr. MG1655)
TDPFUCACTRANS-RXN [EC: 2.3.1.210]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.210

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>HEPCGN_13260 dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase (Escherichia coli ECOR38)
VPVRASIEPLTWENAFFGVNSAIVRITSEAPLLTPDALAPWSRVQAKIAASNTGELDALQ
QLGFSLVEGEVDLALPVNNASDSGAVVAQETDIPALRQLASAAFAQSRFRAPWYAPDASS
RFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDARIGLLAGRGAGAELMQT
ALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR