Protein Info for HEPCGN_12660 in Escherichia coli ECOR38

Name: yihU
Annotation: sulfolactaldehyde 3-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03446: NAD_binding_2" amino acids 4 to 160 (157 residues), 166.6 bits, see alignment E=7.3e-53 PF03807: F420_oxidored" amino acids 4 to 70 (67 residues), 34.2 bits, see alignment E=4.6e-12 PF14833: NAD_binding_11" amino acids 165 to 284 (120 residues), 86.6 bits, see alignment E=2.5e-28

Best Hits

Swiss-Prot: 99% identical to SQUU_ECOLI: 3-sulfolactaldehyde reductase (yihU) from Escherichia coli (strain K12)

KEGG orthology group: K08318, putative dehydrogenase [EC: 1.1.-.-] (inferred from 100% identity to ect:ECIAI39_3118)

MetaCyc: 99% identical to 3-sulfolactaldehyde reductase (Escherichia coli K-12 substr. MG1655)
4-hydroxybutyrate dehydrogenase. [EC: 1.1.1.61]; RXN-15299 [EC: 1.1.1.61, 1.1.1.373]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.-.-

Use Curated BLAST to search for 1.1.-.- or 1.1.1.373 or 1.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>HEPCGN_12660 sulfolactaldehyde 3-reductase (Escherichia coli ECOR38)
MAAIAFIGLGQMGSPMASNLLQQGHQLCVFDVNAEAVRHLVDKGATPAANPAQAAKDAEF
IITMLPNGDLVRSVLFGENGVCESLSTDALVIDMSTIHPLQTDKLIADMQARGFSMMDVP
VGRTSANAITGTLLLLAGGTAEQVERATPILMAMGSELINAGGPGMGIRVKLINNYMSIA
LNALSAEAAVLCEALNLPFDVAVKVMSGTAAGKGHFTTSWPNKVLSGDLSPAFMIDLAHK
DLGIALDVANQLHVPMPLGAASREVYSQARAAGRGRQDWSAILEQVRVSAGMTAKVKM