Protein Info for HEPCGN_11955 in Escherichia coli ECOR38

Name: purD
Annotation: Phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 425 (425 residues), 632.6 bits, see alignment E=1.5e-194 PF02844: GARS_N" amino acids 1 to 102 (102 residues), 135.1 bits, see alignment E=3.4e-43 PF01071: GARS_A" amino acids 103 to 296 (194 residues), 284.3 bits, see alignment E=1.3e-88 PF02655: ATP-grasp_3" amino acids 104 to 291 (188 residues), 29 bits, see alignment E=2.6e-10 PF02786: CPSase_L_D2" amino acids 109 to 270 (162 residues), 26 bits, see alignment E=1.6e-09 PF02843: GARS_C" amino acids 332 to 422 (91 residues), 114.2 bits, see alignment E=7.1e-37

Best Hits

Swiss-Prot: 99% identical to PUR2_ECOL6: Phosphoribosylamine--glycine ligase (purD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 100% identity to ecm:EcSMS35_4453)

MetaCyc: 98% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>HEPCGN_11955 Phosphoribosylamine--glycine ligase (Escherichia coli ECOR38)
MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA
QNEKIDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA
EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA
GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT
DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM
LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS
DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG
WRAIEREQN