Protein Info for HEPCGN_11655 in Escherichia coli ECOR38

Name: psiE
Annotation: phosphate-starvation-inducible protein PsiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details PF06146: PsiE" amino acids 19 to 131 (113 residues), 81.5 bits, see alignment E=2.9e-27

Best Hits

Swiss-Prot: 100% identical to PSIE_SHIDS: Protein PsiE (psiE) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K13256, protein PsiE (inferred from 100% identity to eco:b4030)

Predicted SEED Role

"PsiE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>HEPCGN_11655 phosphate-starvation-inducible protein PsiE (Escherichia coli ECOR38)
MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEG
LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILL
LVITLWLCNSKRLKRE