Protein Info for HEPCGN_11605 in Escherichia coli ECOR38

Name: ubiC
Annotation: chorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF04345: Chor_lyase" amino acids 18 to 165 (148 residues), 106.4 bits, see alignment E=6.8e-35

Best Hits

Swiss-Prot: 100% identical to UBIC_ECO24: Chorismate pyruvate-lyase (ubiC) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 99% identity to eco:b4039)

MetaCyc: 99% identical to chorismate lyase (Escherichia coli K-12 substr. MG1655)
Chorismate lyase. [EC: 4.1.3.40]

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>HEPCGN_11605 chorismate lyase (Escherichia coli ECOR38)
MSHPALTQLRALRYFKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNE
IPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLF
TSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY