Protein Info for HEPCGN_11560 in Escherichia coli ECOR38

Name: dusA
Annotation: tRNA dihydrouridine(20/20a) synthase DusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00742: tRNA dihydrouridine synthase A
  • amino acids 26 to 342 (317 residues), 581 bits, E=3.6e-179
• PF01207: Dus
  • amino acids 30 to 338 (309 residues), 341.1 bits, E=3e-106

Best Hits

Swiss-Prot: 100% identical to DUSA_ECOLI: tRNA-dihydrouridine(20/20a) synthase (dusA) from Escherichia coli (strain K12)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 99% identity to sbc:SbBS512_E4546)

MetaCyc: 100% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (345 amino acids)

>HEPCGN_11560 tRNA dihydrouridine(20/20a) synthase DusA (Escherichia coli ECOR38)
MHGNSEMQKINQTSAMPEKTDVHWSGRFSVAPMLDWTDRHCRYFLRLLSRNTLLYTEMVT
TGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAQCAKLAEARGYDEINLNVGCPSDRVQ
NGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGEC
EMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLQ
HMDGVMVGREAYQNPGILAAVDREIFGSSDTDADPVAVVRAMYPYIERELSQGTYLGHIT
RHMLGLFQGVPGARQWRRYLSENAHKAGADINVLEHALKLVADKR