Protein Info for HEPCGN_11300 in Escherichia coli ECOR38

Name: phnK
Annotation: phosphonate C-P lyase system protein PhnK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR02323: phosphonate C-P lyase system protein PhnK" amino acids 3 to 250 (248 residues), 410.4 bits, see alignment E=1.2e-127 PF00005: ABC_tran" amino acids 22 to 173 (152 residues), 120.7 bits, see alignment E=1.1e-38 PF08352: oligo_HPY" amino acids 225 to 251 (27 residues), 26.6 bits, see alignment (E = 9.6e-10)

Best Hits

Swiss-Prot: 99% identical to PHNK_ECOLI: Putative phosphonates utilization ATP-binding protein PhnK (phnK) from Escherichia coli (strain K12)

KEGG orthology group: K05781, putative phosphonate transport system ATP-binding protein (inferred from 99% identity to eco:b4097)

MetaCyc: 99% identical to ATP-binding cassette protein PhnK (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphonates transport ATP-binding protein PhnK" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>HEPCGN_11300 phosphonate C-P lyase system protein PhnK (Escherichia coli ECOR38)
MNQPLLSVNNLTHLYAPGKGFSDVSFDLWPGEVLGIVGESGSGKTTLLKSISARLTPQQG
EIRYENRSLYGMSEADRRRLLRTEWGVVHQHPLDGLRRQVSAGGNIGERLMATGARHYGD
IRATAQKWLEEVEIPANRIDDLPTTFSGGMQQRLQIARNLVTHPKLVFMDEPTGGLDVSV
QARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVMKQGQVVESGLTDRVLDDPHHP
YTQLLVSSVLQN