Protein Info for HEPCGN_11210 in Escherichia coli ECOR38

Name: pmrB
Annotation: two-component system sensor histidine kinase PmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details PF00512: HisKA" amino acids 147 to 203 (57 residues), 42.7 bits, see alignment E=4.7e-15 PF02518: HATPase_c" amino acids 252 to 359 (108 residues), 74.6 bits, see alignment E=8.3e-25

Best Hits

Swiss-Prot: 98% identical to BASS_ECOLI: Sensor protein BasS (basS) from Escherichia coli (strain K12)

KEGG orthology group: K07643, two-component system, OmpR family, sensor histidine kinase BasS [EC: 2.7.13.3] (inferred from 100% identity to ect:ECIAI39_4536)

MetaCyc: 98% identical to sensor histidine kinase BasS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>HEPCGN_11210 two-component system sensor histidine kinase PmrB (Escherichia coli ECOR38)
LNLIRFLRRPISLRQRLILTIGAILLVFELISVFWLWHESTEQIQLFEQALRDNRNNDRH
IMREIREAVASLIVPGVFMVSLTLFICYQAVRRITRPLAELQKELEARTADNLTPIAIHS
ATLEIEAVVSALNDLVSRLTSTLDNERLFTADVAHELRTPLAGVRLHLELLAKTHHIDVA
SLVARLDQMMESVSQLLQLARAGQSFSSGNYQHVKLLEDVILPSYDELSTMLDQRQQNLL
LPESAADITVQGDATLLRMLLRNLVENAHRYSPQGSNIMIKLQEDGGAVMAVEDEGPGID
ESKCGELSKAFVRMDSRYGGIGLGLSIVSRITQLHHGQFFLQNRQETSGTRAWVRLKKDQ
YVVNQI