Protein Info for HEPCGN_10785 in Escherichia coli ECOR38

Annotation: ligand-gated channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 32 to 656 (625 residues), 413.9 bits, see alignment E=6.7e-128 PF07715: Plug" amino acids 46 to 149 (104 residues), 82.7 bits, see alignment E=2.6e-27 PF00593: TonB_dep_Rec" amino acids 238 to 629 (392 residues), 128.3 bits, see alignment E=7.7e-41

Best Hits

Swiss-Prot: 45% identical to HMUR_YERPE: Hemin receptor (hmuR) from Yersinia pestis

KEGG orthology group: None (inferred from 99% identity to eci:UTI89_C1129)

Predicted SEED Role

"membrane; Transport of small molecules: Cations"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (656 amino acids)

>HEPCGN_10785 ligand-gated channel (Escherichia coli ECOR38)
MYMNVIRTVICTLIIVPVGLQAATSHSSMAKDTITIVATGNQNTVFETPSMVSVVTNDTP
WSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVLVLVDGVRQLSDMAKSSGT
YLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADFLPPGETNGLSLWGNIASGDH
STGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGERAPNKEKPAALFAKGSVGITDSNKA
GASLRLYRNNTTEPGNPTQTHGDSGLRDRKTVQNDVQFWYQYAPVDNSLINVKSTLYLSD
ITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFPGAHQLSYGAEYYRQQQKPEGSATLYP
EGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDRYKSFNPRAGELKAERLSPRAAISVSPTD
WLMMYGSISSAFRAPTMAEMYRDDVHFYRKGKPNYWVPNLNLKPENNITREIGAGIQLDG
LLTDNDRLQLKGGYFGTDARNYIATRVDMKRMRSYSYNVSRARIWGWDMQGNYQSDYVDW
VLSYNRTESMDASSREWLGSGNPDTLISDISIPVGHRGVYAGWRAELSASATHVKKGDSY
QAGYAIHSFSLSYKPVSVKGFEASVTLDNAFNKLAMNGKGVPLSGRTVSLYTRYQW