Protein Info for HEPCGN_10395 in Escherichia coli ECOR38

Name: yjfP
Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details PF01738: DLH" amino acids 17 to 231 (215 residues), 21.4 bits, see alignment E=4.9e-08 PF00561: Abhydrolase_1" amino acids 28 to 146 (119 residues), 33.2 bits, see alignment E=1.3e-11 PF12146: Hydrolase_4" amino acids 28 to 134 (107 residues), 37.3 bits, see alignment E=5.7e-13 PF12697: Abhydrolase_6" amino acids 31 to 207 (177 residues), 28.6 bits, see alignment E=6.7e-10 PF00326: Peptidase_S9" amino acids 52 to 234 (183 residues), 45.7 bits, see alignment E=1.8e-15

Best Hits

Swiss-Prot: 99% identical to YJFP_ECOLI: Esterase YjfP (yjfP) from Escherichia coli (strain K12)

KEGG orthology group: K06889, (no description) (inferred from 99% identity to eco:b4190)

MetaCyc: 99% identical to carboxylesterase (Escherichia coli K-12 substr. MG1655)
Carboxylesterase. [EC: 3.1.1.1]

Predicted SEED Role

"YjfP protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>HEPCGN_10395 esterase (Escherichia coli ECOR38)
MIEIESRELADIPVLHAYPVGQKDTPLPCVIFYHGFTSSSLVYSYFAVALAQAGLRVIMP
DAPDHGSRFSGDAARRLNQFWQILLQSMQEFTTLRAAIAEENWLRDDRLAVGGASMGAMT
ALGITARHPTVKCTASMMGSGYFTSLARSLFPPLIPETAAQQNEFNNIVAPLAEWEATNH
LEQLGDRPLLLWHGLDDDVVPADESLRLQQALSETGRDKLLTCSWQPGVRHRITPEALDA
AVTFFRQHL