Protein Info for HEPCGN_10345 in Escherichia coli ECOR38

Name: rpsF
Annotation: 30S ribosomal protein S6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00166: ribosomal protein bS6" amino acids 1 to 94 (94 residues), 131 bits, see alignment E=7.4e-43 PF01250: Ribosomal_S6" amino acids 3 to 91 (89 residues), 109.5 bits, see alignment E=3.9e-36

Best Hits

Swiss-Prot: 100% identical to RS6_ECO55: 30S ribosomal protein S6 (rpsF) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K02990, small subunit ribosomal protein S6 (inferred from 100% identity to eco:b4200)

MetaCyc: 100% identical to 30S ribosomal subunit protein S6 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S6p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>HEPCGN_10345 30S ribosomal protein S6 (Escherichia coli ECOR38)
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYV
LMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANET
ADDAEAGDSEE