Protein Info for HEPCGN_10300 in Escherichia coli ECOR38

Name: ycjR
Annotation: sugar phosphate isomerase/epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01261: AP_endonuc_2
  • amino acids 28 to 266 (239 residues), 130 bits, E=6.4e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_4673)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• plastoquinol-9 biosynthesis I (1/3 steps found)
• L-tyrosine degradation I (2/5 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Protein Sequence (280 amino acids)

>HEPCGN_10300 sugar phosphate isomerase/epimerase (Escherichia coli ECOR38)
MRDLLQRPDLFSINTATLGYKTPLPAIIDACAARGIGAIAPWRKELQSENLQQIARQLAA
SNMNVSGLCRSTYYTAPTLAERKLAIDDNRRALDDAAVLNAACYMQVVGGLPMGTKDLYE
AREQVKQGIRQLLPHSKDVGVPIALEPLHPMTAADRSCLCTLRQALDWCDELDPDGEFGL
GVAVDVYHVWWDPDLASQILRAGKRILAFHVSDWLVPTTDLVNDRGMPGDGVINIPSIRR
LVENAGFNGAIELEIFSPYWWQQDIDSTLDISVDRIAHYC