Protein Info for HEPCGN_10290 in Escherichia coli ECOR38

Name: acrR
Annotation: TetR/AcrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00440: TetR_N" amino acids 19 to 61 (43 residues), 53 bits, see alignment 2.4e-18 PF17938: TetR_C_29" amino acids 83 to 201 (119 residues), 104.2 bits, see alignment E=5.1e-34

Best Hits

KEGG orthology group: None (inferred from 98% identity to sfv:SFV_4282)

Predicted SEED Role

"FIG00640016: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>HEPCGN_10290 TetR/AcrR family transcriptional regulator (Escherichia coli ECOR38)
MYLDTSNVQSLKEKLLLCAVNEFAEYGYEGARVDNIVKAAGCSKQTVYHHFGNKENLFIE
VLEYTWNDIRQKEKALDFSDLPPQKAIEKIIDFTWDYYISNPWFLKIVHSENQSKGVHYA
KSQRLLEINHAHLQLMESLLDEGKKHNIFKPDIDPLQVNINIAALGGYYLINQHTLGLVY
HISMVSPQALEARRKVIKETILSWLLVDPSSTARE