Protein Info for HEPCGN_10200 in Escherichia coli ECOR38

Name: tamA
Annotation: autotransporter assembly complex protein TamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF17243: POTRA_TamA_1" amino acids 26 to 100 (75 residues), 77.1 bits, see alignment E=1.4e-25 PF07244: POTRA" amino acids 189 to 256 (68 residues), 41.8 bits, see alignment E=2.1e-14 PF01103: Omp85" amino acids 269 to 574 (306 residues), 116.4 bits, see alignment E=3.1e-37

Best Hits

Swiss-Prot: 100% identical to TAMA_ECOLI: Translocation and assembly module subunit TamA (tamA) from Escherichia coli (strain K12)

KEGG orthology group: K07278, outer membrane protein (inferred from 100% identity to eco:b4220)

Predicted SEED Role

"Uncharacterized protein YtfM precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>HEPCGN_10200 autotransporter assembly complex protein TamA (Escherichia coli ECOR38)
VRYIRQLCCVSLLCLSGSAVAANVRLQVEGLSGQLEKNVRAQLSTIESDEVTPDRRFRAR
VDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPGVPVLIGGTDVVLRGGARTD
KDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEFTKAQLGIALGLHKAFWD
IDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKDLAELNRRLSATGWFNSVV
VAPQFDKARETKVLPLTGVVSPRTENTIETGVGYSTDVGPRVKATWKKPWMNSYGHSLTT
STSISAPEQILDFSYKMPLLKNPLEQYYLVQGGFKRTDLNDTESDSTTLVASRYWDLSSG
WQRAINLRWSLDHFTQGEITNTTMLFYPGVMISRTRSRGGLMPTWGDSQRYSIDYSNTAW
GSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGWIETGDFDKVPPDLRFFAGGDRSIRGYK
YKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGAVFVDSGEAVSDIRRSDFKTGTGV
GVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPEL