Protein Info for HEPCGN_10055 in Escherichia coli ECOR38

Annotation: ArgR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF01316: Arg_repressor" amino acids 14 to 75 (62 residues), 51.3 bits, see alignment E=7.9e-18 PF02863: Arg_repressor_C" amino acids 88 to 152 (65 residues), 50.4 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 37% identical to ARGR_AERS4: Arginine repressor (argR) from Aeromonas salmonicida (strain A449)

KEGG orthology group: None (inferred from 100% identity to ecp:ECP_4496)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>HEPCGN_10055 ArgR family transcriptional regulator (Escherichia coli ECOR38)
MKEYDDYSAKEKKQLAVCQRLITEKSYLSQEEIRRDLQNHGFDSISQSTVSRLLKLLGVI
KIRNTKGQKIYSVNPQLLPTPDAGRSVAEMVLSVEHNGEFILIHTVAGYGRAVARILDFH
ALPEILGVIAGSNIVWVAPRVVKRTALVHKQINYLLKLNIYS