Protein Info for HEPCGN_09820 in Escherichia coli ECOR38

Name: fecA
Annotation: Fe(3+) dicitrate transport protein FecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07660: STN" amino acids 57 to 107 (51 residues), 41.2 bits, see alignment 2.3e-14 TIGR01783: TonB-dependent siderophore receptor" amino acids 132 to 774 (643 residues), 545.9 bits, see alignment E=7.8e-168 PF07715: Plug" amino acids 132 to 244 (113 residues), 73.5 bits, see alignment E=3.7e-24 PF00593: TonB_dep_Rec" amino acids 325 to 741 (417 residues), 176.7 bits, see alignment E=3.2e-55 PF14905: OMP_b-brl_3" amino acids 436 to 756 (321 residues), 36.9 bits, see alignment E=5e-13

Best Hits

Swiss-Prot: 99% identical to FECA_ECOLI: Fe(3+) dicitrate transport protein FecA (fecA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to eck:EC55989_4964)

MetaCyc: 99% identical to ferric citrate outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1684

Predicted SEED Role

"Iron(III) dicitrate transport protein FecA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (774 amino acids)

>HEPCGN_09820 Fe(3+) dicitrate transport protein FecA (Escherichia coli ECOR38)
MTPLRVFRKTTPLVNAIRLSLLPLAGLSFSAFAAQVNIAPGSLDKALNQYAAHSGFTLSV
DASLTRGKQSNGLHGDYDVESGLQQLLDGSGLQVKPLGNNSWTLEPAPAPKEDALTVVGD
WLGDARENDVFEHAGARDVIRREDFAKTGATTMREVLNRIPGVSAPENNGTGSHDLAMNF
GIRGLNPRLASRSTVLMDGIPVPFAPYGQPQLSLAPISLGNMDAIDVVRGGGAVRYGPQS
VGGVVNFVTRAIPQDFGIEAGVEGQLSPTSSQNNPKETHNLMVGGTADNGFGTALLYSGT
RGSDWREHSATRIDDLMLKSKYAPDEVHTFNSLLQYYDGEADMPGGLSRADYDADRWQST
RPYDHFWGRRKLASLGYQFQPDSQHKFNIQGVYTQTLRSGYLEQGKRITLSPRNYWVRGI
EPRYSQIFMIGPSAHEVGVGYRYVNESTHEMRYYTATSSGQLPSGSSPYDRDTRSGTEAH
AWYLDDKIDIGNWTITPGMRFEHIESYQNNAITGTHEEVSYNAPLPALNVLYHLTDSWNL
YANTEGSFGTVQYSQIGKAVQSGNVEPEKARTWELGTRYDDGALTAEMGLFLINFNNQYD
SNQTNDTVTARGKTRHTGLETQARYDLGTLTPTLDNVSIYASYAYVNAEIREKGDTYGNL
VPFSPKHKGTLGVDYKPGNWTFNLNSDFQSSQFADNANTVKESADGSTGRIPGFMLWGAR
VAYDFGPQMADLNLAFGVKNIFDQDYFIRSYDDNNKGIYAGQPRTLYMQGSLKF