Protein Info for HEPCGN_08520 in Escherichia coli ECOR38

Name: gspE
Annotation: type II secretion system protein GspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 333 to 351 (19 residues), see Phobius details PF05157: MshEN" amino acids 8 to 69 (62 residues), 24.5 bits, see alignment E=2.6e-09 PF00437: T2SSE" amino acids 88 to 353 (266 residues), 348.6 bits, see alignment E=2e-108

Best Hits

Swiss-Prot: 98% identical to HOFB_ECOLI: Protein transport protein HofB homolog (hofB) from Escherichia coli (strain K12)

KEGG orthology group: K02504, protein transport protein HofB (inferred from 100% identity to ect:ECIAI39_0107)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>HEPCGN_08520 type II secretion system protein GspE (Escherichia coli ECOR38)
MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFATTKRIEITCWTRQQME
GHANRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEPADNAYRIRLRIDGVLH
PLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTIELAGNAVSFRIATLACRGGEKV
VLRLLQQVNQALDVNTLGMQPSQLVDFAHALQQPQGLVLVTGPTGSGKTVTLYSALQTLN
TADINICSVEDPVEIPIAGLNQTQIHSRAGLTFQGVLRALLRQDPDVIMIGEIRDGETAE
IAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSSALTLVIAQRLVRKLCPHCRR
QQGEPIHIPDNVWPSPLPRWQAPGCVHCYHGFYGRTALFEVLPITPFIRQLISANTDVES
LETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMPHGE