Protein Info for HEPCGN_07490 in Escherichia coli ECOR38

Name: prpR
Annotation: propionate catabolism operon regulatory protein PrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 8 to 528 (521 residues), 885 bits, see alignment E=8.7e-271 PF06506: PrpR_N" amino acids 36 to 196 (161 residues), 175.1 bits, see alignment E=2.4e-55 PF14532: Sigma54_activ_2" amino acids 219 to 398 (180 residues), 63.3 bits, see alignment E=7.2e-21 PF00158: Sigma54_activat" amino acids 219 to 393 (175 residues), 219.8 bits, see alignment E=4.6e-69 PF01078: Mg_chelatase" amino acids 226 to 366 (141 residues), 21.1 bits, see alignment E=4.5e-08 PF02954: HTH_8" amino acids 498 to 527 (30 residues), 39 bits, see alignment (E = 1.4e-13)

Best Hits

Swiss-Prot: 99% identical to PRPR_ECOLI: Propionate catabolism operon regulatory protein (prpR) from Escherichia coli (strain K12)

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 100% identity to ect:ECIAI39_0349)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>HEPCGN_07490 propionate catabolism operon regulatory protein PrpR (Escherichia coli ECOR38)
MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLGFEKAVTYIRKKLANE
RCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLTSSIGVVTYQETIPALV
AFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLITDLAEEAGMTGIFIYSAA
TVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQSPQMEQVRQTILLYARSSA
AVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAVNCGAIAESLLEAELFGYEE
GAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLLRVLEEKEVTRVGGHQPVPVD
VRVISATHCNLEEDMRQGEFRRDLFYRLSILRLQLPPLRERVADILPLAESFLKVSLAAL
AAPFSSALRQGLQASETVLVHYDWPGNIRELRNMMERLALFLSVEPTPDLTPQFLQLLLP
ELARESAKTPAPRLLTPQQALEKFKGDKTAAANYLGISRTTFWRRLKS