Protein Info for HEPCGN_07330 in Escherichia coli ECOR38

Name: tauC
Annotation: taurine ABC transporter permease TauC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>HEPCGN_07330 taurine ABC transporter permease TauC (Escherichia coli ECOR38)
MSVLINEKLHSHRLKWRWPLSRQVTLSIGTLAVLLTVWWAVAALQLISPLFLPPPQQVLA
KLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVLIGIPVGIAMGLSPTVRGILDPVIE
LYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVKSA