Protein Info for HEPCGN_07035 in Escherichia coli ECOR38

Name: thiI
Annotation: tRNA sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR00342: tRNA sulfurtransferase ThiI" amino acids 4 to 377 (374 residues), 488.3 bits, see alignment E=1.6e-150 PF02926: THUMP" amino acids 28 to 162 (135 residues), 111.9 bits, see alignment E=2.9e-36 PF02568: ThiI" amino acids 175 to 369 (195 residues), 274.6 bits, see alignment E=4.4e-86 TIGR04271: thiazole biosynthesis domain" amino acids 383 to 482 (100 residues), 135.2 bits, see alignment E=7.2e-44

Best Hits

Swiss-Prot: 100% identical to THII_ECO7I: tRNA sulfurtransferase (thiI) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 100% identity to eco:b0423)

MetaCyc: 100% identical to tRNA uridine 4-sulfurtransferase (Escherichia coli K-12 substr. MG1655)
tRNA sulfurtransferase. [EC: 2.8.1.4]; 2.8.1.- [EC: 2.8.1.4]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>HEPCGN_07035 tRNA sulfurtransferase (Escherichia coli ECOR38)
MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRHWDNIEVRAKDENQR
LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEGKTFCVRVKRRGKHDFS
SIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGRYEGIGGFPIGTQEDV
LSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQVAHYLWNRFGSSHRVRFV
AINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGVQALVTGEALGQVSSQTLTN
LRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTMPEYCGVISKSPTVKAVKSKI
EAEEEKFDFSILDKVVEEANNVDIREIAQQTEQEVVEVETVNGFGPNDVILDIRSIDEQE
DKPLKVEGIDVVSLPFYKLSTKFGDLDQSKTWLLWCERGVMSRLQALYLREQGFNNVKVY
RP