Protein Info for HEPCGN_06840 in Escherichia coli ECOR38

Name: ylaC
Annotation: Inner membrane protein YlaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details PF10777: YlaC" amino acids 1 to 152 (152 residues), 236.4 bits, see alignment E=6.1e-75

Best Hits

Swiss-Prot: 100% identical to YLAC_SHIFL: Inner membrane protein YlaC (ylaC) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b0458)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>HEPCGN_06840 Inner membrane protein YlaC (Escherichia coli ECOR38)
MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVAFFATLAVMLQSETLS
GSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWYNTRFVPAALVEAILNS
PRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS