Protein Info for HEPCGN_06675 in Escherichia coli ECOR38

Name: emrA
Annotation: hemolysin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details PF16576: HlyD_D23" amino acids 49 to 322 (274 residues), 40 bits, see alignment E=4.1e-14 TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 185 to 391 (207 residues), 213.7 bits, see alignment E=2.4e-67 PF13437: HlyD_3" amino acids 242 to 341 (100 residues), 57.5 bits, see alignment E=3.2e-19

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to efe:EFER_0544)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>HEPCGN_06675 hemolysin D (Escherichia coli ECOR38)
MNGQLQYNRGLTEPRLPRSALAVRVTAVMLLCFLGWAWYFQLDEVTTGSGTVEPSGREQV
VQSLEGGILYHLDVKVGDIVEQGQPLAQLNRTKTESDVQEAMSRLYAALATSARLRAEVS
NKPLVFPDELNKFPELIESETALYNTRRDGLNKATTGLTQGISLVNRELAMTQPLVKQGA
ASSVEVLRLQRQANELENKLSDVRTQYYVQAREELAKANAEVETQRSVIRGREDSLTRLN
FTAPVRGIVQDIDVTTVGGVIAPGGKLMTIVPLDEQLLIEAKISPRDVAFIHPGQKSLVK
ITAYDYSIYGGLPGEVAVISPDTVQDEVRRDVYYYRVYIRTFSNHLENKSKQQFPIFPGM
VATVDIRTGKKSVLDYLLKPFNKAQEALRER