Protein Info for HEPCGN_06630 in Escherichia coli ECOR38

Name: fetA
Annotation: iron ABC transporter ATP-binding protein FetA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00005: ABC_tran" amino acids 23 to 165 (143 residues), 105 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 99% identical to FETA_ECOLI: Probable iron export ATP-binding protein FetA (fetA) from Escherichia coli (strain K12)

KEGG orthology group: K02068, putative ABC transport system ATP-binding protein (inferred from 99% identity to eco:b0490)

Predicted SEED Role

"YbbL ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>HEPCGN_06630 iron ABC transporter ATP-binding protein FetA (Escherichia coli ECOR38)
MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPT
SGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNQQPDPAIFLDF
LERFALPDTILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMI
HRYVHEQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYELA