Protein Info for HEPCGN_06580 in Escherichia coli ECOR38

Name: mnmH
Annotation: tRNA 2-selenouridine(34) synthase MnmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00581: Rhodanese" amino acids 11 to 128 (118 residues), 24.2 bits, see alignment E=1.9e-09 TIGR03167: tRNA 2-selenouridine synthase" amino acids 17 to 349 (333 residues), 351.9 bits, see alignment E=1.8e-109

Best Hits

Swiss-Prot: 98% identical to SELU_ECO57: tRNA 2-selenouridine/geranyl-2-thiouridine synthase (selU) from Escherichia coli O157:H7

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 98% identity to eco:b0503)

MetaCyc: 98% identical to tRNA 2-selenouridine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-2281 [EC: 2.9.1.3]

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.- or 2.9.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>HEPCGN_06580 tRNA 2-selenouridine(34) synthase MnmH (Escherichia coli ECOR38)
MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERAAVGTCYKQQGS
DAALALGHKLVPGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQRWLHDAGINYPL
VEGGYKALRQTAIQATIELSQKPIVLIGGCTGSGKTLLVQQQPNGVDLEGLARHRGSAFG
RTLQPQLSQASFENLLAAEMLKTDARQNLRLWVLEDESRMIGSNHLPECLRERMTQAAIA
VVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEYLHHGLSAIKRRLGLQRYNE
LTARLDAALTTQLTTGSTDGHLAWLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWTEVAEW
VKAQ