Protein Info for HEPCGN_06440 in Escherichia coli ECOR38

Name: fimA
Annotation: type 1 fimbrial major subunit FimA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00419: Fimbrial" amino acids 30 to 179 (150 residues), 102.9 bits, see alignment E=1e-33

Best Hits

Swiss-Prot: 100% identical to SFMA_ECO57: Uncharacterized fimbrial-like protein SfmA (sfmA) from Escherichia coli O157:H7

KEGG orthology group: K07352, type 1 fimbrial protein (inferred from 100% identity to eco:b0530)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>HEPCGN_06440 type 1 fimbrial major subunit FimA (Escherichia coli ECOR38)
MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTD
IFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIASSTNTTTATGVG
IEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRYE