Protein Info for HEPCGN_06435 in Escherichia coli ECOR38

Name: fimC
Annotation: type 1 fimbria chaperone FimC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00345: PapD_N" amino acids 26 to 145 (120 residues), 128.5 bits, see alignment E=1.5e-41 PF02753: PapD_C" amino acids 167 to 222 (56 residues), 41.6 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 99% identical to SFMC_ECOLI: Probable fimbrial chaperone SfmC (sfmC) from Escherichia coli (strain K12)

KEGG orthology group: K07353, fimbrial chaperone protein (inferred from 99% identity to eco:b0531)

Predicted SEED Role

"Fimbrial periplasmic chaperone SfmC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>HEPCGN_06435 type 1 fimbria chaperone FimC (Escherichia coli ECOR38)
MMTKIKLLMLIIFYLIISTSAHAGGGIALGATRIIYPADAKQTAVWIRNSHTNERFLVNS
WIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRESLFWMNVKTIPSVDKN
ALNGRNVLQLAILSRMKLFLRPIQLQELPAEAPDTLKFSRSGNYINVHNPSPFYVTLVNL
QVGSQKLGNAMAAPRVNSQIPLPSGVQGKLKFQTVNDYGSVTPVREVNLN