Protein Info for HEPCGN_06390 in Escherichia coli ECOR38

Name: gpA1
Annotation: terminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 PF05876: GpA_ATPase" amino acids 47 to 285 (239 residues), 175.9 bits, see alignment E=1.2e-55 PF20454: GpA_nuclease" amino acids 322 to 600 (279 residues), 252.4 bits, see alignment E=5.6e-79

Best Hits

Swiss-Prot: 99% identical to TERL_LAMBD: Terminase, large subunit (A) from Escherichia phage lambda

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_1509)

Predicted SEED Role

"Phage terminase, large subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (641 amino acids)

>HEPCGN_06390 terminase (Escherichia coli ECOR38)
VNISNSQVNRLRHFVRAGLRSLFRPEPQTAVEWADANYYLPKESAYQEGRWETLPFQRAI
MNAMGSDYIREVNVVKSARVGYSKMLLGVYAYFIEHKQRNTLIWLPTDGDAENFMKTHVE
PTIRDIPSLLALAPWYGKKHRDNTLTMKRFTNGRGFWCLGGKAAKNYREKSVDVAGYDEL
AAFDDDIEQEGSPTFLGDKRIEGSVWPKSIRGSTPKVRGTCQIERAASESPHFMRFHVAC
PHCGEEQYLKFGDKETPFGLKWSPDDPSSVFYLCEHNACVIRQQELDFTDARYICEKTGI
WTRDGILWFSSSGEEIEPPDSVTFHIWTAYSPFTTWVQIVKDWMKTKGDTGKRKTFVNTT
LGETWEAKIGERPDAEVMAERKEHYSAPVPDRVAYLTAGIDSQLDRYEMRVWGWGPGEES
WLIDRQIIMGRHDDEQTLQRVDEAINKTYTRRNGAEMSVSRICWDTGGIDPTIVYERSKK
HGLFRVIPIKGASVYGKPVASMPRKRNKNGVYLTEIGTDTAKEQIYNRFTLTPEGDEPLP
GAVHFPNNPDIFDLTEAQQLTAEEQVEKWVDGRKKILWDSKKRRNEALDCFVYALAALRI
SISRWQLDLSALLASLQEEDGAATNKKTLADYARALSGEDE