Protein Info for HEPCGN_06125 in Escherichia coli ECOR38

Name: clcB
Annotation: voltage-gated ClC-type chloride channel ClcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 18 to 45 (28 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 1 to 247 (247 residues), 207.8 bits, see alignment E=1.4e-65

Best Hits

Predicted SEED Role

"FIG00509904: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>HEPCGN_06125 voltage-gated ClC-type chloride channel ClcB (Escherichia coli ECOR38)
MAAAYRAPLAGSLFIAEVLFGTMMLASLGPVIISAVVALLVSNLINHSDALLYSVQLSVT
VQARDYALIISTGVLAGLCGPLLLTLMNACHRGFVSLKLAPPWQLALGGLIVGLLSLFTP
AVWGNGYSTVQSFLTAPPLLMIIAGIFLCKLFAVLASSGSGAPGGVFTPTLFIGLAIGML
YGRSLGLWFPDGEEITLLLGLTGMATLLAATTHAPIMSTLMICEMTGEYQLLPGLLIACV
IASVISRTLHRDSIYRQHTAKHS