Protein Info for HEPCGN_06110 in Escherichia coli ECOR38

Name: ynfL
Annotation: Uncharacterized HTH-type transcriptional regulator YnfL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 229 to 249 (21 residues), see Phobius details PF00126: HTH_1" amino acids 5 to 64 (60 residues), 83.4 bits, see alignment E=8.5e-28 PF03466: LysR_substrate" amino acids 88 to 296 (209 residues), 164 bits, see alignment E=3.2e-52

Best Hits

Swiss-Prot: 100% identical to YNFL_ECOLI: Uncharacterized HTH-type transcriptional regulator YnfL (ynfL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1595)

Predicted SEED Role

"LysR family transcriptional regulator YnfL" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>HEPCGN_06110 Uncharacterized HTH-type transcriptional regulator YnfL (Escherichia coli ECOR38)
MNIELRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQIGARLLARTNRSVLLT
AAGKQFLADSRQILSMVDDAAARAERLHQGEAGELRIGFTSSAPFIRAVSDTLSLFRRDY
PDVHLQTREMNTREQIAPLIEGTLDMGLLRNTALPETLEHAVIVHEPLMAMIPHDHPLAN
NPNVTLAELAKEPFVFFDPHVGTGLYDDILGLMRRYHLTPVITQEVGEAMTIIGLVSAGL
GVSILPASFKRVQLNEMRWVPIAEEDAVSEMWLVWPKHHEQSPAARNFRIHLLNALR