Protein Info for HEPCGN_06080 in Escherichia coli ECOR38

Name: mdtJ
Annotation: multidrug/spermidine efflux SMR transporter subunit MdtJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 21 (3 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 4 to 94 (91 residues), 98.7 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 98% identical to MDTJ_SHIDS: Spermidine export protein MdtJ (mdtJ) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K11743, spermidine export protein MdtJ (inferred from 100% identity to ect:ECIAI39_1458)

MetaCyc: 98% identical to multidrug/spermidine efflux pump membrane subunit MdtJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-350; TRANS-RXN0-266

Predicted SEED Role

"Spermidine export protein MdtJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>HEPCGN_06080 multidrug/spermidine efflux SMR transporter subunit MdtJ (Escherichia coli ECOR38)
MYIYWILLGLAIATEITGTLFMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA
YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKAHKPELEVNHGA
V