Protein Info for HEPCGN_06060 in Escherichia coli ECOR38

Name: ydgH
Annotation: DUF1471 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07338: YdgH_BhsA-like" amino acids 35 to 90 (56 residues), 66 bits, see alignment E=1.2e-22 amino acids 119 to 174 (56 residues), 66.2 bits, see alignment E=1.1e-22 amino acids 259 to 314 (56 residues), 74.6 bits, see alignment E=2.6e-25

Best Hits

Swiss-Prot: 100% identical to YDGH_ECOLI: Protein YdgH (ydgH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sfl:SF1625)

Predicted SEED Role

"Protein ydgH precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>HEPCGN_06060 DUF1471 domain-containing protein (Escherichia coli ECOR38)
MKLKNTLLASALLSATAFSVNAATELTPEQAAAVKPFDRVVVTGRFNAIGEAVKAVSRRA
DKEGAASFYVVDTSDFGNSGNWRVVADLYKADAEKAEETSNRVINGVVELPKDQAVLIEP
FDTVTVQGFYRSQPEVNDAITKAAKAKGAYSFYIVRQIDANQGGNQRITAFIYKKDAKKR
IVQSPDVIPADSEAGRAALAAGGEAAKKVEIPGVATTASPSSEVGRFFETQSSKGGRYTV
TLPDGTKVEELNKATAAMMVPFDSIKFSGNYGNMTEVSYQVAKRAAKKGAKYYHITRQWQ
ERGNNLTVSADLYK