Protein Info for HEPCGN_06050 in Escherichia coli ECOR38

Name: folM
Annotation: dihydromonapterin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 184 (176 residues), 64.6 bits, E=8.6e-22
• PF13561: adh_short_C2
  • amino acids 18 to 238 (221 residues), 77.9 bits, E=9.3e-26

Best Hits

Swiss-Prot: 100% identical to FOLM_ECOL6: Dihydromonapterin reductase (folM) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K13938, dihydromonapterin reductase / dihydrofolate reductase [EC: 1.5.1.- 1.5.1.3] (inferred from 99% identity to ecp:ECP_1550)

MetaCyc: 98% identical to dihydromonapterin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6367 [EC: 1.5.1.50]; Dihydrofolate reductase. [EC: 1.5.1.50, 1.5.1.3]

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• tetrahydromonapterin biosynthesis (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• Methane metabolism
• One carbon pool by folate
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 1.5.1.3

Use Curated BLAST to search for 1.5.1.- or 1.5.1.3 or 1.5.1.50

Protein Sequence (240 amino acids)

>HEPCGN_06050 dihydromonapterin reductase (Escherichia coli ECOR38)
MGKTQSLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPTIDGLIKAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSLPLDGGRHLR