Protein Info for HEPCGN_06040 in Escherichia coli ECOR38

Name: rstA
Annotation: two-component system response regulator RstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00072: Response_reg" amino acids 4 to 112 (109 residues), 71.8 bits, see alignment E=5.4e-24 PF00486: Trans_reg_C" amino acids 158 to 233 (76 residues), 76.9 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 99% identical to RSTA_ECOLI: Transcriptional regulatory protein RstA (rstA) from Escherichia coli (strain K12)

KEGG orthology group: K07661, two-component system, OmpR family, response regulator RstA (inferred from 99% identity to eco:b1608)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>HEPCGN_06040 two-component system response regulator RstA (Escherichia coli ECOR38)
MNTIVFVEDDAEVGSLIAAYLAKHDMQVTVEPRGDRAEETILRENPDLVLLDIMLPGKDG
MTICRDLRAKWSGPIVLLTSLDSDMNHILALEMGACDYILKTTPPAVLLARLRLHLRQNE
QATVTKGIQETSLTPYKALHFGTLTIDPINRVVTLANTEISLSTADFELLWELATHAGQI
MDRDALLKNLRGVSYDGLDRSVDVAISRLRKKLLDNAAEPYRIKTVRNKGYLFAPHAWE