Protein Info for HEPCGN_05960 in Escherichia coli ECOR38

Name: add
Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR01430: adenosine deaminase" amino acids 6 to 330 (325 residues), 362 bits, see alignment E=1.2e-112 PF00962: A_deaminase" amino acids 7 to 332 (326 residues), 447.7 bits, see alignment E=1.3e-138

Best Hits

Swiss-Prot: 100% identical to ADD_ECO7I: Adenosine deaminase (add) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 100% identity to ect:ECIAI39_1434)

MetaCyc: 99% identical to adenosine deaminase (Escherichia coli K-12 substr. MG1655)
Adenosine deaminase. [EC: 3.5.4.4]; 3.5.4.4 [EC: 3.5.4.4]

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>HEPCGN_05960 adenosine deaminase (Escherichia coli ECOR38)
MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFL
TKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVI
DGVCEGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLF
LSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQI
GIESCLTSNIQTSTVAELAAHPLKMFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGL
SREQIRQAQINGLEMAFLSAEEKRALREKVAAK