Protein Info for HEPCGN_05930 in Escherichia coli ECOR38

Name: rsxC
Annotation: electron transport complex subunit RsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 740 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 13 to 445 (433 residues), 596 bits, see alignment E=1.7e-183 PF13375: RnfC_N" amino acids 14 to 115 (102 residues), 109.1 bits, see alignment E=5.6e-35 PF01512: Complex1_51K" amino acids 139 to 283 (145 residues), 163.3 bits, see alignment E=2.1e-51 PF10531: SLBB" amino acids 296 to 344 (49 residues), 32.6 bits, see alignment 3.1e-11 PF13237: Fer4_10" amino acids 373 to 427 (55 residues), 27.2 bits, see alignment 1.7e-09 PF13183: Fer4_8" amino acids 375 to 430 (56 residues), 30.2 bits, see alignment 3.1e-10 PF12838: Fer4_7" amino acids 376 to 430 (55 residues), 37.2 bits, see alignment 1.8e-12 PF13534: Fer4_17" amino acids 376 to 430 (55 residues), 23.8 bits, see alignment 3e-08

Best Hits

Swiss-Prot: 100% identical to RSXC_ECO7I: Ion-translocating oxidoreductase complex subunit C (rsxC) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 100% identity to ect:ECIAI39_1427)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (740 amino acids)

>HEPCGN_05930 electron transport complex subunit RsxC (Escherichia coli ECOR38)
MLKLFSAFRKNKIWDFNGGIHPPEMKTQSNGTPLRQVPLAQRFVIPLKQHIGAEGELCVS
VGDKVLRGQPLTRGRGKMLPVHAPTSGTVTAIAPHSTAHPSALAELSVIIDADGEDCWIP
RDGWDDYRSRSREELIERIHKFGVAGLGGAGFPTGVKLQGGGDKIETLIINAAECEPYIT
ADDRLMQDCAAQVVEGIRILAHILQPREILIGIEDNKPQAISMLRAVLADSHDISLRVIP
TKYPSGGAKQLTYILTGKQVPHGGRSSDIGVLMQNVGTAYAVKRAVIDGEPITERVVTLT
GEAIARPGNVWARLGTPVRHLLNDAGFCPSADQMVIMGGPLMGFTLPWLDVPVVKITNCL
LAPSANELGEPQEEQSCIRCSACADACPADLLPQQLYWFSKGQQHDKATTHNIADCIECG
ACAWVCPSNIPLVQYFRQEKAEIAAIRQEEKRAAEAKARFEARQARLEREKAARLERHKS
AAVQPAAKDKDAIAAALARVKEKQAQATQPIVIKAGERPDNSAIIAAREARKAQARAKQA
KLQQTNDAATVADPRKTAVEAAIARAKARKLEQQQANAEPEQQVDPRKAAVEAAIARAKA
RKLEQQQANAEPEQQVDPRKAAVEAAIARAKARKLEQQQANAEPEQQVDPRKAAVEAAIA
RAKARKLEQQQANAEPEEQVDPRKAAVEAAIARAKARKLEQKQANAVPEEQVDPRKAAVA
AAIARVQAKKAAQQKVVNED