Protein Info for HEPCGN_05215 in Escherichia coli ECOR38

Name: nudG
Annotation: CTP pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 4 to 125 (122 residues), 81.2 bits, E=7e-27
• PF14815: NUDIX_4
  • amino acids 7 to 123 (117 residues), 73.7 bits, E=1.1e-24

Best Hits

Swiss-Prot: 98% identical to NUDG_ECOLI: CTP pyrophosphohydrolase (nudG) from Escherichia coli (strain K12)

KEGG orthology group: K08320, CTP pyrophosphohydrolase [EC: 3.6.1.-] (inferred from 100% identity to ecm:EcSMS35_1430)

MetaCyc: 98% identical to 5-hydroxy-CTP diphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-6957 [EC: 3.6.1.56]; 3.6.1.- [EC: 3.6.1.56]; RXN0-7291 [EC: 3.6.1.56]

Predicted SEED Role

"5-methyl-dCTP pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

MetaCyc Pathways

• pyrimidine deoxyribonucleotides dephosphorylation (3/3 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.56

Protein Sequence (135 amino acids)

>HEPCGN_05215 CTP pyrophosphohydrolase (Escherichia coli ECOR38)
MKMIEVVAAIIERDGKILLAQRPAHSDQAGLWEFAGGKVEPDESQRQALVRELREELGIE
AAVGEYVASHQREVSGRIIHLHAWHVPDFHGTLQAHEHQALVWCSPEEALQYPLAPADIP
LLEAFMALRAARPAD