Protein Info for HEPCGN_04930 in Escherichia coli ECOR38

Name: yoaE
Annotation: CNNM family cation transport protein YoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details PF03741: TerC" amino acids 14 to 203 (190 residues), 158.6 bits, see alignment E=2.1e-50 PF03471: CorC_HlyC" amino acids 434 to 510 (77 residues), 63.8 bits, see alignment E=1.8e-21

Best Hits

Swiss-Prot: 100% identical to YOAE_ECOLI: UPF0053 inner membrane protein YoaE (yoaE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1816)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>HEPCGN_04930 CNNM family cation transport protein YoaE (Escherichia coli ECOR38)
MEFLMDPSIWAGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARLLGLSLALIMRLG
LLSLISWMVTLTKPLFTVMDFSFSGRDLIMLFGGIFLLFKATTELHERLENRDHDSGHGK
VYASFWVVVTQIVILDAVFSLDAVITAVGMVNHLPVMMAAVVIAMAVMLLASKPLTRFVN
QHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSIIIEVFNQIARRNFIRHQS
TLPLRARTADAILRLMGGKRQANVQHDADNPMPMPIPEGAFAEEERYMINGVLTLASRSL
RGIMTPRGEISWVDANLGVDEIREQLLSSPHSLFPVCRGELDEIIGIVRAKELLVALEEG
VDVAAIASASPAIIVPETLDPINLLGVLRRARGSFVIVTNEFGVVQGLVTPLDVLEAIAG
EFPDADETPEIITDGDGWLVKGGTDLHALQQALDVEHLADDDDIATVAGLVISANGHIPR
VGDVIDVGPLHITIIEANDYRVDLVRIVKEQPAHDEDE