Protein Info for HEPCGN_04900 in Escherichia coli ECOR38

Name: rlmA
Annotation: 23S rRNA (guanine(745)-N(1))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF21302: Zn_ribbon_RlmA" amino acids 3 to 46 (44 residues), 87.1 bits, see alignment 2.6e-28 PF05175: MTS" amino acids 78 to 131 (54 residues), 24.9 bits, see alignment E=6.4e-09 PF01209: Ubie_methyltran" amino acids 83 to 175 (93 residues), 22.9 bits, see alignment E=2.3e-08 PF13847: Methyltransf_31" amino acids 84 to 189 (106 residues), 55 bits, see alignment E=3.3e-18 PF13649: Methyltransf_25" amino acids 89 to 172 (84 residues), 56.7 bits, see alignment E=1.4e-18 PF08241: Methyltransf_11" amino acids 90 to 175 (86 residues), 49.9 bits, see alignment E=1.8e-16 PF08242: Methyltransf_12" amino acids 90 to 155 (66 residues), 35.7 bits, see alignment E=5.6e-12

Best Hits

Swiss-Prot: 99% identical to RLMA_ECOLI: 23S rRNA (guanine(745)-N(1))-methyltransferase (rlmA) from Escherichia coli (strain K12)

KEGG orthology group: K00563, 23S rRNA (guanine745-N1)-methyltransferase [EC: 2.1.1.187] (inferred from 99% identity to eco:b1822)

MetaCyc: 99% identical to 23S rRNA m1G745 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11573 [EC: 2.1.1.187]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase A (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.51

Use Curated BLAST to search for 2.1.1.187 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>HEPCGN_04900 23S rRNA (guanine(745)-N(1))-methyltransferase (Escherichia coli ECOR38)
MSFSCPLCHQPLSREKNSYICPLRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIVAQLRERLDEKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKV
AIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPG
PRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSDELCYPMRLRGDEAVALLQMTPFAWRA
KPEVWQTLAAKEVFDCQTDFNIHLWQRSY