Protein Info for HEPCGN_04810 in Escherichia coli ECOR38

Name: copD
Annotation: copper homeostasis membrane protein CopD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF10709: DUF2511" amino acids 26 to 113 (88 residues), 152.1 bits, see alignment E=2.3e-49

Best Hits

Swiss-Prot: 99% identical to YEBY_SHIFL: Uncharacterized protein YebY (yebY) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to eco:b1839)

Predicted SEED Role

"FIG00923183: possible membrane protein YebY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>HEPCGN_04810 copper homeostasis membrane protein CopD (Escherichia coli ECOR38)
MMKKSILAFLLLTSSAAALAAPQVITVSRFEVGKDKWAFNREEVMLTCRPGNALYVINPS
TLVQYPLNDIAQKEVASGKTKAQPISVIQIDDPNNPGEKMSLAPFIERAEKLC