Protein Info for HEPCGN_04440 in Escherichia coli ECOR38

Annotation: DUF2511 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF10709: DUF2511" amino acids 28 to 113 (86 residues), 28 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to eck:EC55989_2087)

Predicted SEED Role

"unknown protein encoded by prophage CP-933T"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>HEPCGN_04440 DUF2511 domain-containing protein (Escherichia coli ECOR38)
MKVKKVQLLVTFLSMFSFSALAMPFKTIERESFNGVWPFNTDEVQLQCLDGNPYVMNFDD
NKLYALTGLARIKGKTFGALPLDNNNPFWLDNDAAPGLKKSLGDVTKAAFDLCDK