Protein Info for HEPCGN_04255 in Escherichia coli ECOR38

Annotation: phage tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF12571: DUF3751" amino acids 1 to 150 (150 residues), 208.6 bits, see alignment E=7e-66 PF03406: Phage_fiber_2" amino acids 169 to 209 (41 residues), 72.2 bits, see alignment 3.2e-24 amino acids 213 to 253 (41 residues), 68.3 bits, see alignment 5.1e-23 PF07484: Collar" amino acids 389 to 436 (48 residues), 50 bits, see alignment 3.5e-17

Best Hits

KEGG orthology group: None (inferred from 94% identity to ecg:E2348C_1827)

Predicted SEED Role

"Phage tail fiber protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>HEPCGN_04255 phage tail protein (Escherichia coli ECOR38)
MTVKYYAILTNQGAARLANATMLGSKLNLTQMAVGDANGVLPTPDPAQTKLINQKRIAPL
NLLSVDPNNQSQIIAEQIIPENEGGFWIREIGLYDDEGVLIAVANCPETYKPQLQEGSGR
TQTIRMILVVTNTEAITLKIDPSVVLATRKYVDDKISEHEQSRRHPDASLTVKGFTQLSS
AINSESETLAATPKAVKAAYDLANGKYTAQNATTTQKGIVQLSSATNSTYETLAATPKAV
KVVMDETNKKAPLNSPALTGTPTTPTAPQGTNNTQIASTAFVMAAIAALVDSSPDALNTL
NELAAALGNDPNFATTMTNALAGKQPKDATLTALAKLATSADKLPYFTGADRAALTALTS
VGRAILGKTSTQGVLDYLGLGEGSALPVGVPVPWPSATPPTGWLKCNGAAFSSEMYPRLA
MAYPTNKLPDLRGEFIRGWDDGRGVDAGRGILSMQGWLTGSHYHNIRSWDAWDNTVLVPN
DKGGDSLLSTDNAVRQGAINGRFTSQYRTESSGGNEARPRNIAFNYIVRTA