Protein Info for HEPCGN_04225 in Escherichia coli ECOR38

Annotation: phage major tail tube protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR01611: phage major tail tube protein" amino acids 3 to 169 (167 residues), 122.6 bits, see alignment E=7.5e-40 PF04985: Phage_tube" amino acids 4 to 168 (165 residues), 158 bits, see alignment E=9.7e-51

Best Hits

Swiss-Prot: 69% identical to TAILC_BPSK2: Major tail tube protein from Serratia phage KSP20

KEGG orthology group: None (inferred from 98% identity to cro:ROD_36521)

Predicted SEED Role

"Phage major tail tube protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>HEPCGN_04225 phage major tail tube protein (Escherichia coli ECOR38)
MAVPKHLRFFTLFVDGENEVGKVTSVTLPKLTRKTDSYRGGGMMGAVSIDLGLDDSALDA
SFVMGGAVRALFLKYGGTIDGTLLRFAGEYYTDAESDLYEIEMRGRVTEIDMGEAKQGEA
TSHTYAIKNTYYKLSVNDRPLWEIDLLNFIYRKDGKDIVPDRIRSALGLG