Protein Info for HEPCGN_04165 in Escherichia coli ECOR38

Name: sdiA
Annotation: transcriptional regulator SdiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF03472: Autoind_bind" amino acids 23 to 160 (138 residues), 123.5 bits, see alignment E=5.3e-40 PF00196: GerE" amino acids 179 to 234 (56 residues), 80.2 bits, see alignment E=6.7e-27

Best Hits

Swiss-Prot: 98% identical to SDIA_ECOLI: Regulatory protein SdiA (sdiA) from Escherichia coli (strain K12)

KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 98% identity to eco:b1916)

Predicted SEED Role

"N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional activator @ N-3-oxooctanoyl-L-homoserine lactone quorum-sensing transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>HEPCGN_04165 transcriptional regulator SdiA (Escherichia coli ECOR38)
MQDTDFFSWLRTMLLRFQRMEAAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFY
TNYPESWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVT
QYLMLPNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNF
SKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI