Protein Info for HEPCGN_04045 in Escherichia coli ECOR38

Name: fliL
Annotation: flagellar basal body-associated protein FliL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 12 to 13 (2 residues), see Phobius details transmembrane" amino acids 14 to 35 (22 residues), see Phobius details PF03748: FliL" amino acids 56 to 152 (97 residues), 70.5 bits, see alignment E=7.7e-24

Best Hits

Swiss-Prot: 100% identical to FLIL_ECOL6: Flagellar protein FliL (fliL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02415, flagellar FliL protein (inferred from 100% identity to eco:b1944)

Predicted SEED Role

"Flagellar biosynthesis protein FliL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>HEPCGN_04045 flagellar basal body-associated protein FliL (Escherichia coli ECOR38)
MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQRVVPSPVFYALD
TFTVNLGDADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKK
NLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFILR