Protein Info for HEPCGN_04035 in Escherichia coli ECOR38
Name: fliN
Annotation: flagellar motor switch protein FliN
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to FLIN_ECOLI: Flagellar motor switch protein FliN (fliN) from Escherichia coli (strain K12)
KEGG orthology group: K02417, flagellar motor switch protein FliN/FliY (inferred from 98% identity to sbo:SBO_1061)Predicted SEED Role
"Flagellar motor switch protein FliN" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (137 amino acids)
>HEPCGN_04035 flagellar motor switch protein FliN (Escherichia coli ECOR38) MSDMNNPADDNNGAMDDLWAEALSEQKSTSGKSAADAVFQQFGGGDVSGTLQDIDLIMDI PVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGV RITDIITPSERMRRLSR