Protein Info for HEPCGN_03465 in Escherichia coli ECOR38

Name: cobS
Annotation: adenosylcobinamide-GDP ribazoletransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 185 to 216 (32 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 1 to 246 (246 residues), 303.9 bits, see alignment E=4.9e-95 PF02654: CobS" amino acids 8 to 244 (237 residues), 186.2 bits, see alignment E=4.3e-59

Best Hits

Swiss-Prot: 100% identical to COBS_ECOL5: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 98% identity to eco:b1992)

MetaCyc: 98% identical to cobalamin 5'-phosphate synthase (Escherichia coli K-12 substr. MG1655)
Adenosylcobinamide-GDP ribazoletransferase. [EC: 2.7.8.26]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>HEPCGN_03465 adenosylcobinamide-GDP ribazoletransferase (Escherichia coli ECOR38)
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG
VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV
VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ
TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIEFGEL
VFLLALL