Protein Info for HEPCGN_03445 in Escherichia coli ECOR38

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF02195: ParBc" amino acids 56 to 118 (63 residues), 38.1 bits, see alignment E=6.8e-14

Best Hits

Swiss-Prot: 59% identical to YBDM_ECOLI: Uncharacterized protein YbdM (ybdM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ecm:EcSMS35_3152)

Predicted SEED Role

"Co-activator of prophage gene expression IbrB" in subsystem IbrA and IbrB: co-activators of prophage gene expression

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>HEPCGN_03445 transcriptional regulator (Escherichia coli ECOR38)
MGDSVTPEVEVLSNMIRQYFSQERSEEETIRALNHLRRVLHEVSPFAQEPVDCVLWVKAD
EVVANDYNPNVMSSSEKKLLKHSLEQDGFTQPVVVSEEKEHYLVVDGFHRQLLGRKADTR
KRLKGWLPVTCINPERKGQASRIAATIRHNRARGKHQITSMSDIVRDLSRLGWTDERIGT
ELGMDQDEVLRLKQISGLTELFQEENFSPSWTVR