Protein Info for HEPCGN_03180 in Escherichia coli ECOR38

Name: ugd
Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 169 (169 residues), 114.2 bits, see alignment E=8.4e-37 TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 378 (378 residues), 343.8 bits, see alignment E=6.4e-107 PF00984: UDPG_MGDP_dh" amino acids 192 to 281 (90 residues), 97 bits, see alignment E=8.5e-32 PF03720: UDPG_MGDP_dh_C" amino acids 300 to 376 (77 residues), 37 bits, see alignment E=5.7e-13

Best Hits

Swiss-Prot: 100% identical to UDG_ECO57: UDP-glucose 6-dehydrogenase (ugd) from Escherichia coli O157:H7

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 99% identity to eco:b2028)

MetaCyc: 99% identical to UDP-glucose 6-dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>HEPCGN_03180 UDP-glucose 6-dehydrogenase (Escherichia coli ECOR38)
MKITISGTGYVGLSNGLLIAQNHEVVALDILPSRVAMLNDRISPIVDKEIQQFLQSDKIH
FNATLDKNEAYRDADYVIIATPTDYDPKTNYFNTSSVESVIKDVVEINPYAVMVIKSTVP
VGFTEAMHKKYRTENIIFSPEFLREGKALYDNLHPSRIVIGERSERAERFAALLQEGAIK
QNIPTLFTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNTRQIIEGVCLDPRIGN
HYNNPSFGYGGYCLPKDTKQLLANYQSVPNNLISAIVDANRTRKDFIADAILSRKPQVVG
IYRLIMKSGSDNFRASSIQGIMKRIKAKGVEVIIYEPVMKEDSFFNSRLERDLATFKQQA
DVIISNRMAEELKDVADKVYTRDLFGSD